PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.18G067400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB
Protein Properties Length: 342aa    MW: 38081 Da    PI: 6.9046
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.18G067400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.87.1e-201461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT+eEd++lvd+++++G ++W++ ++  g++R++k+c++rw +yl
  Manes.18G067400.1.p 14 KGPWTPEEDQKLVDYIQKHGHRSWRALPKLAGLNRCGKSCRLRWTNYL 61
                         79********************************************97 PP

2Myb_DNA-binding54.72.3e-1767112148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          rg++++eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++l
  Manes.18G067400.1.p  67 RGKFSEEEEKTILNLHSVLGNK-WSAIASHLP-GRTDNEIKNFWNTHL 112
                          89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129419.014961IPR017930Myb domain
SuperFamilySSF466896.6E-3211108IPR009057Homeodomain-like
SMARTSM007177.2E-161363IPR001005SANT/Myb domain
PfamPF002492.9E-181461IPR001005SANT/Myb domain
CDDcd001677.18E-131661No hitNo description
PROSITE profilePS5129426.14562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2765117IPR009057Homeodomain-like
SMARTSM007179.0E-1766114IPR001005SANT/Myb domain
PfamPF002492.1E-1667112IPR001005SANT/Myb domain
CDDcd001678.87E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTPE EDQKLVDYIQ KHGHRSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SEEEEKTILN LHSVLGNKWS AIASHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHQPRT DIFASLPHLV ALLNLKDLLD RHPLDEHAMR LQAEAIQLAK LQYLRYLLQS  180
ATSITSNSYT QNGTTDMEIL SLLSQIPVMK ETPLLNSSQL ENINPASSNP FGIATSQPLH  240
YSNLLPQLSD PQVPFNCQPS LNNEMGQAAT LSAMLNDGDN SNPSDSSWVL RSPTPSIPPT  300
VTDTSISNNL GDASSTSSYG GGTSSYWPEF FLDDSIMHQI S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-33121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015571465.10.0PREDICTED: protein ODORANT1
TrEMBLA0A067KYV40.0A0A067KYV4_JATCU; MYB family protein
STRINGPOPTR_0005s17080.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-103myb domain protein 93